PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_37831_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26225 Da    PI: 6.1744
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_37831_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.18.6e-27959151
                                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                k+i+n++ rqvtf+kRr g++KKAeEL +LCda+va+iifsstgkl++y+s
  Cotton_A_37831_BGI-A2_v1.0  9 KKIDNSTARQVTFAKRRRGLFKKAEELAILCDADVALIIFSSTGKLFDYAS 59
                                68***********************************************86 PP

2K-box45.82.7e-161051713298
                       K-box  32 qreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                                  +++R++ Ge+L+ L+++eLqqLe+ Le +l+++ +kK + ++++i++lq+k  +l een++L++++
  Cotton_A_37831_BGI-A2_v1.0 105 SHQLRQMRGEELHGLNIEELQQLEKSLEIGLSRVMEKKGQRIMREINDLQRKGMQLMEENERLKQQI 171
                                 4789*************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.829161IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-38160IPR002100Transcription factor, MADS-box
CDDcd002653.89E-39270No hitNo description
PRINTSPR004041.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-30372IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.50887177IPR002487Transcription factor, K-box
PfamPF014861.8E-1594171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MAREKIQIKK IDNSTARQVT FAKRRRGLFK KAEELAILCD ADVALIIFSS TGKLFDYASS  60
SMKEILERHH LRSKNLEKLE QPCLGLQLVE HSNQSMLTME IAEKSHQLRQ MRGEELHGLN  120
IEELQQLEKS LEIGLSRVME KKGQRIMREI NDLQRKGMQL MEENERLKQQ IINGPRQVAG  180
DSDNIIFGEE GQSSESVTNV CTSNGYHILV NCAGGFVAID LEYDINDHLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D6e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A6e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1556350.0KC155635.1 Gossypium hirsutum MADS box protein MADS40 mRNA, complete cds.
GenBankKC1556630.0KC155663.1 Gossypium hirsutum MADS box protein MADS68 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437242.11e-145PREDICTED: MADS-box protein SVP isoform X1
RefseqXP_012437243.11e-145PREDICTED: MADS-box protein SVP isoform X1
RefseqXP_012437244.11e-145PREDICTED: MADS-box protein SVP isoform X1
RefseqXP_012437245.11e-145PREDICTED: MADS-box protein JOINTLESS isoform X2
SwissprotQ9FUY63e-99JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A0D2RCD71e-145A0A0D2RCD7_G
STRINGVIT_00s0313g00070.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-97MIKC_MADS family protein